518-831-8000 sales@utechproducts.com

AGPAT9, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AGPAT9, Each

1,069.20

Details:

Glycerol-3-phosphate (G3P) acyltransferases (GPAT; EC 2.3.1.15), such as GPAM (MIM 602395) and GPAT3, catalyze the initial step of de novo triacylglycerol (TAG) synthesis by converting glycerol-3-phosphate (G3P) to lysophosphatidic acid (LPA) (Cao et al., 2006 [PubMed 17170135]).[supplied by OMIMSequence: ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN

Additional Information

SKU 10288373
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22285