518-831-8000 sales@utechproducts.com

Agps Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Agps, Each

$ 1,757.70

Details

This gene is a member of the fad-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (dhap) is converted to alkyl-dhap by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires fad as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and zellweger syndrome. [Provided by refseqsequence: keritreckekgvqfapfstcrvtqtydagaciyfyfafnyrgisdpltvfeqteaaareeilanggslshhhgvgklrkqwlkesisdvgfgmlks

Additional Information

SKU 10288480
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22416