518-831-8000 sales@utechproducts.com

AGRP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AGRP, Each

1,092.83

Details:

Agouti-related protein is an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation. Agouti-related protein is alternatively spliced into 2 variants which differ in 5' untranslated sequence length. [provided by RefSeqSequence: PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM

Additional Information

SKU 10289627
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23735