AGXT2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AGXT2, Each
$ 1,069.20
|
|
Details:
The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. [provided by RefSeqSequence: DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
Additional Information
| SKU | 10289066 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23103 |
