518-831-8000 sales@utechproducts.com

Alas2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Alas2, Each

$ 1,757.70

Details

The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause x-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [Provided by refseqsequence: gnyvfsydqffrdkimekkqdhtyrvfktvnrwadaypfaqhfseasvaskdvsvwcsndylgmsrhpqvlqatqetlqrhgagaggtrnisgtskfhveleqelaelhqkdsallfsscfvandstlftlakilpgceiysdagnhas

Additional Information

SKU 10292349
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28468