ALDH1A3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ALDH1A3, Each
$ 1,069.20
|
|
Details:
Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The enzyme encoded by this gene uses retinal as a substrate, either in a free or cellular retinol-binding protein form. [provided by RefSeqSequence: ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
Additional Information
| SKU | 10290160 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24490 |
