518-831-8000 sales@utechproducts.com

AP2M1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AP2M1, Each

1,069.20

Details:

This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Additional Information

SKU 10289041
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23071