518-831-8000 sales@utechproducts.com

Arhgap27, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arhgap27, Each

$ 1,757.70

Details

Rho (see arha; mim 165390)-like small gtpases are involved in many cellular processes, and they are inactive in the gdp-bound state and active in the gtp-bound state. Gtpase-activating proteins, such as arhgap27, inhibit rho-like proteins by stimulating their intrinsic gtpase activity (katoh and katoh, 2004 [pubmed 15492870]).[Supplied by omimsequence: wtvleggvltffkdsktsaagglrqpskfstpeytvelrgatlswapkdkssrknvlelrsrdgseyliqhdseaiistwhkaiaqgiqe

Additional Information

SKU 10287805
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21625