518-831-8000 sales@utechproducts.com

Ascl4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ascl4, Each

$ 1,757.70

Details

Basic helix-loop-helix transcription factors, such as ascl4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (jonsson et al., 2004 [Pubmed 15475265]).[Supplied by omimsequence: metrkpaerlalpyslrtaplgvpgtlpglprrdplrvalrldaacwewarsgcargwqylpvpldsafepaf

Additional Information

SKU 10288936
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22948