518-831-8000 sales@utechproducts.com

Atp1b1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Atp1b1, Each

$ 1,757.70

Details

The protein encoded by this gene belongs to the family of na /k and h /k atpases beta chain proteins, and to the subfamily of na /k -atpases. Na /k -atpase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of na and k ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of na /k -atpase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified. [Provided by refseqsequence: sefkptyqdrvappgltqipqiqkteisfrpndpksyeayvlnivrflekykdsaqrddmifedcgdvpsepkergdfnhergerkvcrfklewlgncsglndetygykegkpciiiklnrvlgfkpkppknesletypvmkynpn

Additional Information

SKU 10286944
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20637