ATP4A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ATP4A, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H , K -ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H( ) and K( ) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes a catalytic alpha subunit of the gastric H , K -ATPase. [provided by RefSeqSequence: TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ
Additional Information
| SKU | 10289327 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23402 |
