518-831-8000 sales@utechproducts.com

ATP4A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ATP4A, Each

1,069.20

Details:

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H , K -ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H( ) and K( ) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes a catalytic alpha subunit of the gastric H , K -ATPase. [provided by RefSeqSequence: TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ

Additional Information

SKU 10289327
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23402