518-831-8000 sales@utechproducts.com

B4galnt2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant B4galnt2, Each

$ 1,757.70

Details

B4galnt2 catalyzes the last step in the biosynthesis of the human sd(a) antigen through the addition of an n-acetylgalactosamine residue via a beta-1,4 linkage to a subterminal galactose residue substituted with an alpha-2,3-linked sialic acid. B4galnt2 also catalyzes the last step in the biosynthesis of the cad antigen (montiel et al., 2003 [Pubmed 12678917]).[Supplied by omimsequence: llpeerlrnlfsydgiwlfpknqckceankeqggynfqdaygqsdlpavkarrqaefehfqrreglprplpllvqpnlpfgypvhgvevmplhtvpipglqfegpda

Additional Information

SKU 10287117
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20841