518-831-8000 sales@utechproducts.com

Bank1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bank1, Each

$ 1,757.70

Details

Bank1 is a b-cell-specific scaffold protein and lyn (mim 165120) tyrosine kinase substrate that promotes tyrosine phosphorylation of inositol 1,4,5-trisphosphate receptors (see itpr1; mim 147265) (yokoyama et al., 2002 [Pubmed 11782428]).[Supplied by omimsequence: rhghkelkkifedfsiqeidinneqendyeediasfstyipstqnpafhhesrktygqsadgaeanemegegkqngsgmetkhspl

Additional Information

SKU 10289060
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23096