518-831-8000 sales@utechproducts.com

BGN, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BGN, Each

1,757.70

Details:

The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transferring growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome. [provided by RefSeqSequence: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL

Additional Information

SKU 10292538
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28699