BNIP2 Rabbit anti-Human, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BNIP2, Each
$ 1,069.20
|
|
Details:
This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. [provided by RefSeqSequence: VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
Additional Information
| SKU | 10288002 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21843 |
