BTG2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BTG2, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeqSequence: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Additional Information
| SKU | 10292409 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28556 |
