BTG3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BTG3, Each
$ 1,069.20
|
|
Details:
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Additional Information
| SKU | 10287278 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21035 |
