C12orf30, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C12orf30, Each
$ 1,069.20
|
|
Details:
MDM20 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIMSequence: TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL
Additional Information
| SKU | 10289336 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23412 |
