C19orf40 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C19orf40, Each
$ 1,069.20
|
|
Details
FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIMSequence: AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL
Additional Information
| SKU | 10292119 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28196 |
Loading Cart Data 