518-831-8000 sales@utechproducts.com

C19orf40 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C19orf40, Each

1,757.70

Details:

FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIMSequence: AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL

Additional Information

SKU 10292119
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28196