518-831-8000 sales@utechproducts.com

C2orf56, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C2orf56, Each

1,069.20

Details

The function of this gene is not known, however, its existence is supported by mRNAs and EST data. Transcript variants encoding different isoforms have been noted for this gene.Sequence: ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD

Additional Information

SKU 10290076
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24396