518-831-8000 sales@utechproducts.com

C6orf190, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C6orf190, Each

1,757.70

Details:

This gene encodes a protein that plays a regulatory role in both positive and negative T-cell selection during late thymocyte development. The protein functions through T-cell antigen receptor signaling, and is necessary for proper lineage commitment and maturation of T-cells. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: EGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSF

Additional Information

SKU 10288797
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22780