C8B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C8B, Each
$ 1,069.20
|
|
Details
C8 beta is one of the three subunits that comprise the component 8 (C8) of the complement system. C8 participates in the formation of Membrane Attack Complex that results in the lysis of cells. Patients with C8B deficiency are prone to bacteria infection. [provided by RefSeqSequence: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Additional Information
| SKU | 10287781 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21600 |
Loading Cart Data 