518-831-8000 sales@utechproducts.com

C9 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C9, Each

$ 1,757.70

Details

This gene encodes the final component of the complement system. It participates in the formation of the membrane attack complex (mac). The mac assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause component c9 deficiency. [Provided by refseqsequence: clgyhldvslafseisvgaefnkddcvkrgegravnitsenliddvvslirggtrkyafelkekllrgtvidvtdfvnwassindapvlisqklspiynlvpvkmknahlkkqnleraiedyinefsvrkchtcqnggtvilmdgk

Additional Information

SKU 10288392
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22308