518-831-8000 sales@utechproducts.com

Caly, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Caly, Each

$ 1,757.70

Details

The protein encoded by this gene is a type ii single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with d1 dopamine receptor and may interact with other da receptor subtypes and/or gpcrs. [Provided by refseqsequence: mvklgcsfsgkpgkdpgdqdgaamdsvplispldisqlqpplpdqvviktqteyqlsspdqqnfpdlegqrlncshpeegrrlptarmi

Additional Information

SKU 10289798
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23919