518-831-8000 sales@utechproducts.com

CBS, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CBS, Each

1,757.70

Details:

The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. [provided by RefSeqSequence: GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR

Additional Information

SKU 10292285
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28399