518-831-8000 sales@utechproducts.com

Cc2d2a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cc2d2a, Each

$ 1,757.70

Details

This gene encodes a coiled-coil and calcium binding domain protein that appears to play a critical role in cilia formation. Mutations in this gene cause meckel syndrome type 6, as well as joubert syndrome type 9. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: svtpndqcpraevsrredvkkrsvylkvlfnnkevsrtvsrplgadfrvhfgqifnlqivnwpesltlqvyetvghssptllaevflpipettvvtgrapteevefssn

Additional Information

SKU 10289987
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24295