518-831-8000 sales@utechproducts.com

CCT5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CCT5, Each

1,773.90

Details:

This gene encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeqSequence: LDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQM

Additional Information

SKU 10292396
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28543