CDAN1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CDAN1, Each

$ 1,069.20
|
Details
This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeqSequence: NCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSSAENIAVGLA
Additional Information
SKU | 10289349 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23425 |