518-831-8000 sales@utechproducts.com

Cdh9 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cdh9, Each

$ 1,757.70

Details

This gene encodes a type ii classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large n-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved c-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the protein's homophilic cell adhesion activity. Type ii (atypical) cadherins are defined based on their lack of a hav cell adhesion recognition sequence specific to type i cadherins. [Provided by refseqsequence: giitvkqnldfenqmlytlrvdasnthpdprflhlgpfkdtavvkisvedideppvftkvsylievdedvkegsiigqvtaydpdarnnlikysvdrhtdmdri

Additional Information

SKU 10286699
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20362