CEP112, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CEP112, Each
$ 1,069.20
|
|
Details
This gene encodes a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeqSequence: RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE
Additional Information
| SKU | 10287874 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21702 |
Loading Cart Data 