518-831-8000 sales@utechproducts.com

CHMP4B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CHMP4B, Each

1,757.70

Details:

CHMP4B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIMSequence: SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK

Additional Information

SKU 10291942
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27902