CIB3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CIB3, Each
$ 1,757.70
|
|
Details:
This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. [provided by RefSeqSequence: FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG
Additional Information
| SKU | 10292059 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28132 |
