CIB3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CIB3, Each

Details

This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. [provided by RefSeqSequence: FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG