518-831-8000 sales@utechproducts.com

CLC, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLC, Each

1,069.20

Details:

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeqSequence: LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM

Additional Information

SKU 10289734
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23850