518-831-8000 sales@utechproducts.com

Clcn4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Clcn4, Each

$ 1,757.70

Details

The clcn family of voltage-dependent chloride channel genes comprises nine members (clcn1-7, ka and kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved cpg island and is conserved in both mouse and hamster. This gene is mapped in close proximity to apxl (apical protein xenopus laevis-like) and oa1 (ocular albinism type i), which are both located on the human x chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. [Provided by refseqsequence: vvsrdserligfaqrrelilaiknarqrqegivsnsimyfteeppelpansphplklrrilnls

Additional Information

SKU 10288589
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22540