518-831-8000 sales@utechproducts.com

Clic4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Clic4, Each

$ 1,757.70

Details

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular ph, and regulation of cell volume. Chloride intracellular channel 4 (clic4) protein, encoded by the clic4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in panc-1 cells (pancreatic cancer cells). [Provided by refseqsequence: thppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpdeidensmedikfstrkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgi

Additional Information

SKU 10286738
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20406