518-831-8000 sales@utechproducts.com

Clk3 (M07a), Mouse Anti-Human, Clone: 7d6, Abnova, Mouse Monoclonal Antibody Raised Against A Partial Recombinant Clk3, Each

$ 922.51

Details

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (sr) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [Provided by refseqsequence: ypsrreppprrsrsrshdrlpyqrryrerrdsdtyrceerspsfgedyygpsrsrhrrrsrergpyrtrkhahhchkrrtrscssassrsqqsskrssrsv

Additional Information

SKU 10006435
UOM Each
UNSPSC 12352200
Manufacturer Part Number H00001198M07A