518-831-8000 sales@utechproducts.com

CLN5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLN5, Each

1,069.20

Details:

This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage functionSequence: TLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEK

Additional Information

SKU 10291949
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27910