Cox6b1 (M01), Mouse Anti-Human, Clone: 5d3, Abnova, Mouse Monoclonal Antibody Raised Against A Partial Recombinant Cox6b1, Each
$ 922.51
|
|
Details:
Cytochrome c oxidase (cox), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit vib. Three pseudogenes cox6bp-1, cox6bp-2 and cox6bp-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, Respectively. [Provided by refseqsequence: maedmetkiknyktapfdsrfpnqnqtrncwqnyldfhrcqkamtakggdisvcewyqrvyqslcptswvtdwdeqraegtfpgki
Additional Information
| SKU | 10006438 |
|---|---|
| UOM | Each |
| UNSPSC | 12352200 |
| Manufacturer Part Number | H00001340M01 |
