518-831-8000 sales@utechproducts.com

CPM, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CPM, Each

1,069.20

Details:

The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeqSequence: LKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVS

Additional Information

SKU 10292518
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28679