518-831-8000 sales@utechproducts.com

Cytip, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cytip, Each

$ 1,757.70

Details

The protein encoded by this gene contains 2 leucine zipper domains and a putative c-terminal nuclear targeting signal, but does not have any hydrophobic regions. This protein is expressed weakly in resting nk and t cells. The encoded protein modulates the activation of arf genes by cyth1. This protein interacts with cyth1 and snx27 proteins and may act to sequester cyth1 protein in the cytoplasm.[Provided by refseqsequence: payssystltgsltmddnrriqmladtvatlprgrkqlaltrssslsdfswsqrklvtvekqdnetfgfeiqsyrpqnqnacssemftlickiqedspahcaglqagdvlaningvstegf

Additional Information

SKU 10286701
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20364