518-831-8000 sales@utechproducts.com

DACH1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DACH1, Each

1,069.20

Details:

This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Drosophila to human. Expression of this gene is lost in some forms of metastatic cancer, and is correlated with poor prognosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP

Additional Information

SKU 10286922
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20612