518-831-8000 sales@utechproducts.com

Dgcr2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dgcr2, Each

$ 1,757.70

Details

Deletions of the 22q11.2 Have been associated with a wide range of developmental defects (notably digeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome and isolated conotruncal cardiac defects) classified under the acronym catch 22. The dgcr2 gene encodes a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in digeorge syndrome. [Provided by refseqsequence: rfsrkcptgwhhyegtascyrvylsgenywdaaqtcqrlngslatfstdqelrfvlaqewdqpersfgwkdqrklwvgyqyvitgrnrslegrwevafkgssevflppdpifasamsendnvfcaqlqcfhfptlrhhdlhswhaescyekssflckrsqtcvdikdnvvdegfyftpk

Additional Information

SKU 10287320
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21078