518-831-8000 sales@utechproducts.com

Dhx40, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dhx40, Each

$ 1,757.70

Details

Ddx40 is a member of the dexh/d box family of atp-dependent rna helicases. Rna helicases catalyze the unwinding of double-stranded rna and play a role in rna metabolism, including pre-mrna splicing, ribosome biogenesis, and organellar gene expression.[Supplied by omimsequence: svgrtfctmdgrgspvhihpssalheqetklewiifhevlvttkvyarivcpiryewvrdllpklhefnahdlssvarrevredarrrwtnkenvkqlkdgiskdvlkkmqrrnddksisdararf

Additional Information

SKU 10290006
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24320