518-831-8000 sales@utechproducts.com

DNAH8, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DNAH8, Each

1,069.20

Details:

Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains. Dynein heavy chains (DHCs) are responsible for force production and ATPase activity and contain a highly conserved catalytic domain with 4 P-loop consensus motifs involved in nucleotide binding. Two major classes of dyneins, axonemal and cytoplasmic, have been identified. Axonemal dyneins, found in cilia and flagella, are components of the outer and inner dynein arms attached to the peripheral microtubule doublets. DNAH8 is an outer arm axonemal DHC (Chapelin et al., 1997 [PubMed 9256245]; Neesen et al., 1997 [PubMed 9373155]).[supplied by OMIMSequence: ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD

Additional Information

SKU 10288259
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22154