518-831-8000 sales@utechproducts.com

DNAJC6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DNAJC6, Each

1,757.70

Details:

DNAJC6 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIMSequence: NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP

Additional Information

SKU 10288577
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22525