518-831-8000 sales@utechproducts.com

Dpep1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dpep1, Each

$ 1,757.70

Details

Dpep1 (ec 3.4.13.11) Is a kidney membrane enzyme that hydrolyzes a variety of dipeptides and is implicated in renal metabolism of glutathione and its conjugates, e.G., Leukotriene d4 (kozak and tate, 1982 [pubmed 6122685]). Dpep1 is responsible for hydrolysis of the beta-lactam ring of antibiotics, such as penem and carbapenem (campbell et al., 1984 [Pubmed 6334084]). Earlier, beta-lactamase enzymes were thought to occur only in bacteria, where their probable function was in protecting the organisms against the action of beta-lactam antibiotics. These antibiotics exhibit selective toxicity against bacteria but virtual inertness against many eukaryotic cells (adachi et al., 1990 [Pubmed 2303490]).[Supplied by omimsequence: sligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfgqrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrn

Additional Information

SKU 10286932
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20623