518-831-8000 sales@utechproducts.com

Drg2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Drg2, Each

$ 1,757.70

Details

The drg2 gene encodes the developmentally regulated gtp-binding protein 2, a name derived from the fact that it shares significant similarity to known gtp-binding proteins. Drg2 was identified because it is expressed in normal fibroblasts but not in sv40-transformed fibroblasts. Read-through transcripts containing this gene and a downstream gene have been identified, but they are not thought to encode a fusion protein. This gene is located within the smith-magenis syndrome region on chromosome 17. [Provided by refseqsequence: ykifnaevlfredcspdefidvivgnrvympclyvynkidqismeevdrlarkpnsvviscgmklnldyllemlweylaltciytkkrgqrpdftdaiilrkgasvehvchrihrslasqfkyalvwgtstkyspqrvglthtmehedvi

Additional Information

SKU 10286725
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20391