518-831-8000 sales@utechproducts.com

Ergic1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ergic1, Each

$ 1,757.70

Details

This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ergic) protein which interacts with other members of this protein family to increase their turnover. [Provided by refseqsequence: vvnelyvddpdkdsggkidvslnislpnlhcelvgldiqdemgrhevghidnsmkiplnngagcrfegqfsink

Additional Information

SKU 10287403
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21171