518-831-8000 sales@utechproducts.com

EXOC6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant EXOC6, Each

1,069.20

Details

The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE

Additional Information

SKU 10288962
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22976