518-831-8000 sales@utechproducts.com

FAM186B Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FAM186B, Each

1,757.70

Details:

This gene product is a member of the FAM186 family, however, its exact function is not known. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeqSequence: SLIATKRGIESLTALCSTLIEGQKKRSQVSKRTFWQGWQGRSPQTSPSHPQPLSPEQMLQDQHTMNTKASEVTSMLQELLDSTMFSK

Additional Information

SKU 10289481
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23576